PDB entry 1dbx

View 1dbx on RCSB PDB site
Description: Crystal structure of cysteinyl-tRNA(Pro) deacylase from H. influenzae (HI1434)
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, YBAK, Structure 2 Function Project, S2F, HYDROLASE
Deposited on 1999-11-03, released 2000-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.183
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteinyl-tRNA(Pro) deacylase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: YbaK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45202 (Start-157)
      • modified residue (68)
      • modified residue (85)
      • see remark 999 (116)
    Domains in SCOPe 2.07: d1dbxa_
  • Chain 'B':
    Compound: cysteinyl-tRNA(Pro) deacylase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: YbaK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45202 (Start-157)
      • modified residue (68)
      • modified residue (85)
      • see remark 999 (116)
    Domains in SCOPe 2.07: d1dbxb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbxA (A:)
    mtpaidllkkqkipfilhtydhdpnnqhfgdeaaeklgidpnrsfktllvaengdqkkla
    cfvlatanmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinsta
    lefetiyvsggkrglsveiapqdlakvlgaeftdivde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbxA (A:)
    tpaidllkkqkipfilhtydhdpgdeaaeklgidpnrsfktllvaengdqkklacfvlat
    anmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstalefeti
    yvsggkrglsveiapqdlakvlgaeftdivde
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbxB (B:)
    mtpaidllkkqkipfilhtydhdpnnqhfgdeaaeklgidpnrsfktllvaengdqkkla
    cfvlatanmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinsta
    lefetiyvsggkrglsveiapqdlakvlgaeftdivde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbxB (B:)
    tpaidllkkqkipfilhtydhdpgdeaaeklgidpnrsfktllvaengdqkklacfvlat
    anmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstalefeti
    yvsggkrglsveiapqdlakvlgaeftdivde