PDB entry 1dbv

View 1dbv on RCSB PDB site
Description: glyceraldehyde-3-phosphate dehydrogenase mutant with asp 32 replaced by gly, leu 187 replaced by ala, and pro 188 replaced by ser complexed with nad+
Deposited on 1996-12-20, released 1997-07-07
The last revision prior to the SCOP 1.65 freeze date was dated 1997-07-07, with a file datestamp of 1997-07-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.14
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbvO (O:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbvP (P:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbvQ (Q:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbvR (R:)
    avkvgingfgrigrnvfraalknpdievvavngltdantlahllkydsvhgrldaevsvn
    gnnlvvngkeiivkaerdpenlawgeigvdivvestgrftkredaakhleagakkviisa
    pakneditivmgvnqdkydpkahhvisnascttnclapfakvlheqfgivrgmmttvhsy
    tndqrildashkdlrraraaaesiiptttgaakavalvlpelkgklngmamrvptpnvsv
    vdlvaelekevtveevnaalkaaaegelkgilayseeplvsrdyngstvsstidalstmv
    idgkmvkvvswydnetgyshrvvdlaayiaskgl