PDB entry 1dbu

View 1dbu on RCSB PDB site
Description: Crystal structure of cysteinyl-tRNA(Pro) deacylase protein from H. influenzae (HI1434)
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, YBAK, Structure 2 Function Project, S2F, HYDROLASE
Deposited on 1999-11-03, released 2000-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.193
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cysteinyl-tRNA(Pro) deacylase
    Species: Haemophilus influenzae [TaxId:727]
    Gene: YbaK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P45202 (Start-157)
      • modified residue (68)
      • modified residue (85)
      • see remark 999 (116)
    Domains in SCOPe 2.07: d1dbua_
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbuA (A:)
    mtpaidllkkqkipfilhtydhdpnnqhfgdeaaeklgidpnrsfktllvaengdqkkla
    cfvlatanmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinsta
    lefetiyvsggkrglsveiapqdlakvlgaeftdivde
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbuA (A:)
    tpaidllkkqkipfilhtydhdpndeaaeklgidpnrsfktllvaengdqkklacfvlat
    anmlnlkkaaksigvkkvemadkdaaqkstgylvggisplgqkkrvktvinstalefeti
    yvsggkrglsveiapqdlakvlgaeftdivde