PDB entry 1dbt

View 1dbt on RCSB PDB site
Description: crystal structure of orotidine 5'-monophosphate decarboxylase from bacillus subtilis complexed with ump
Class: lyase
Keywords: decarboxylase, ump, tim barrel, lyase
Deposited on 1999-11-03, released 2000-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.193
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dbta_
  • Chain 'B':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dbtb_
  • Chain 'C':
    Compound: orotidine 5'-phosphate decarboxylase
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dbtc_
  • Heterogens: U5P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbtA (A:)
    mknnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfld
    lklhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavt
    qltstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltv
    tpgirmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrlewegiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbtA (A:)
    mknnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfld
    lklhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavt
    qltstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltv
    tpgirmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrlewegi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbtB (B:)
    mknnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfld
    lklhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavt
    qltstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltv
    tpgirmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrlewegiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbtB (B:)
    nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
    lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
    tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
    girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dbtC (C:)
    mknnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfld
    lklhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavt
    qltstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltv
    tpgirmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrlewegiks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbtC (C:)
    nnlpiialdfasaeetlaflapfqqeplfvkvgmelfyqegpsivkqlkerncelfldlk
    lhdipttvnkamkrlaslgvdlvnvhaaggkkmmqaalegleegtpagkkrpsliavtql
    tstseqimkdelliekslidtvvhyskqaeesgldgvvcsvheakaiyqavspsfltvtp
    girmsedaandqvrvatpaiarekgssaivvgrsitkaedpvkaykavrleweg