PDB entry 1dbr

View 1dbr on RCSB PDB site
Description: hypoxanthine guanine xanthine
Class: transferase
Keywords: transferase, glycosyltransferase, purine salvage
Deposited on 1996-02-13, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.168
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypoxanthine guanine xanthine phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dbra_
  • Chain 'B':
    Compound: hypoxanthine guanine xanthine phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dbrb_
  • Chain 'C':
    Compound: hypoxanthine guanine xanthine phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dbrc_
  • Chain 'D':
    Compound: hypoxanthine guanine xanthine phosphoribosyltransferase
    Species: Toxoplasma gondii [TaxId:5811]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1dbrd_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbrA (A:)
    maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
    ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
    dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
    drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbrA (A:)
    askpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklay
    dihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlqndnst
    gqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsn
    slkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbrB (B:)
    maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
    ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
    dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
    drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbrB (B:)
    askpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklay
    dihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlltvlsd
    dlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsnslkgdfvg
    fsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1dbrC (C:)
    maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
    ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
    dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
    drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbrC (C:)
    iedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklaydihr
    tyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlltvlsddlsi
    frdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsnslkgdfvgfsie
    dvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1dbrD (D:)
    maskpiedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrvekla
    ydihrtyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlksyqn
    dnstgqltvlsddlsifrdkhvlivedivdtgftltefgerlkavgpksmriatlvekrt
    drsnslkgdfvgfsiedvwivgccydfnemfrdfdhvavlsdaarkkfekv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbrD (D:)
    iedygkgkgriepmyipdntfynaddflvpphckpyidkillpgglvkdrveklaydihr
    tyfgeelhiicilkgsrgffnllidylatiqkysgressvppffehyvrlltvlsddlsi
    frdkhvlivedivdtgftltefgerlkavgpksmriatlvekrtdrsnslkgdfvgfsie
    dvwivgccydfnemfrdfdhvavlsdaarkkfekv