PDB entry 1dbq

View 1dbq on RCSB PDB site
Description: DNA-binding regulatory protein
Class: DNA-binding regulatory protein
Keywords: transcription regulation, DNA-binding regulatory protein, purine repressor
Deposited on 1996-02-13, released 1996-12-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.156
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: purine repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dbqa_
  • Chain 'B':
    Compound: purine repressor
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1dbqb_
  • Heterogens: MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbqA (A:)
    slkvnhtksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmma
    qkrvdgllvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagry
    lierghreigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqq
    ilsqphrptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihq
    pkdslgetafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbqA (A:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
    eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
    ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
    ldrivnkreepqsievhprlierrsvadgpfrdyrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbqB (B:)
    slkvnhtksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmma
    qkrvdgllvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagry
    lierghreigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqq
    ilsqphrptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihq
    pkdslgetafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbqB (B:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
    eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
    ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
    ldrivnkreepqsievhprlierrsvadgpfrdyrr