PDB entry 1dbq

View 1dbq on RCSB PDB site
Description: dna-binding regulatory protein
Deposited on 1996-02-13, released 1996-12-07
The last revision prior to the SCOP 1.55 freeze date was dated 1996-12-07, with a file datestamp of 1996-12-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.156
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dbqa_
  • Chain 'B':
    Domains in SCOP 1.55: d1dbqb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbqA (A:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
    eigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphr
    ptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslge
    tafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbqA (A:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
    eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
    ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
    ldrivnkreepqsievhprlierrsvadgpfrdyrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1dbqB (B:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
    eigvipgplerntgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphr
    ptavfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslge
    tafnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbqB (B:)
    ksigllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgl
    lvmcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghr
    eigvipgpagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrptavfc
    ggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgetafnml
    ldrivnkreepqsievhprlierrsvadgpfrdyrr