PDB entry 1dbp

View 1dbp on RCSB PDB site
Description: identical mutations at corresponding positions in two homologous proteins with non-identical effects
Class: binding protein
Keywords: binding protein
Deposited on 1994-01-31, released 1994-05-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.16
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-ribose-binding protein
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02925 (0-270)
      • conflict (71)
    Domains in SCOPe 2.03: d1dbpa_
  • Heterogens: RIP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbpA (A:)
    kdtialvvstlnnpffvslkdgaqkeadklgynlvvldsqnnpakelanvqdltvrgtki
    llinptdsdavdnavkmanqanipvitldrqatkgevvshiasdnvlggkiagdyiakka
    gegakvielqgiagtsaarergegfqqavaahkfnvlasqpadfdrikglnvmqnlltah
    pdvqavfaqndemalgalralqtagksdvmvvgfdgtpdgekavndgklaatiaqlpdqi
    gakgvetadkvlkgekvqakypvdlklvvkq