PDB entry 1dbn

View 1dbn on RCSB PDB site
Description: maackia amurensis leukoagglutinin (lectin) with sialyllactose
Deposited on 1999-11-03, released 2000-06-14
The last revision prior to the SCOP 1.55 freeze date was dated 2000-06-14, with a file datestamp of 2000-06-14.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.221
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dbna_
  • Chain 'B':
    Domains in SCOP 1.55: d1dbnb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbnA (A:)
    sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
    nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
    nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
    tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbnB (B:)
    sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
    nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
    nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
    tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl