PDB entry 1dbn

View 1dbn on RCSB PDB site
Description: maackia amurensis leukoagglutinin (lectin) with sialyllactose
Class: sugar binding protein
Keywords: plant lectin, carbohydrate binding, sialyllactose, sugar binding protein
Deposited on 1999-11-03, released 2000-06-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.75 Å
R-factor: 0.221
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (leukoagglutinin)
    Species: Maackia amurensis [TaxId:37501]
    Database cross-references and differences (RAF-indexed):
    • PIR JC5444 (0-238)
      • see remark 999 (59)
      • see remark 999 (127)
    Domains in SCOPe 2.07: d1dbna_
  • Chain 'B':
    Compound: protein (leukoagglutinin)
    Species: Maackia amurensis [TaxId:37501]
    Database cross-references and differences (RAF-indexed):
    • PIR JC5444 (0-238)
      • see remark 999 (59)
      • see remark 999 (127)
    Domains in SCOPe 2.07: d1dbnb_
  • Heterogens: NAG, CA, MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbnA (A:)
    sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
    nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
    nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
    tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbnB (B:)
    sdelsftinnfvpneadllfqgeasvsstgvlqltkvengqpqkysvgralyaapvriwg
    nttgsvasfstsftfvvkapnpditsdglafylappdsqipsgsvskylglfnnsnsdss
    nqivavefdtyfahsydpwdpnyrhigidvngiesiktvqwdwinggvafatitylapnk
    tliaslvypsnqttfsvaasvdlkeilpewvrvgfsaatgyptevethdvlswsftstl