PDB entry 1dbk

View 1dbk on RCSB PDB site
Description: molecular basis of cross-reactivity and the limits of antibody-antigen complementarity
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1993-08-24, released 1994-01-31
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.213
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa db3 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1dbkh1, d1dbkh2
  • Chain 'L':
    Compound: igg1-kappa db3 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB09710 (0-215)
      • conflict (1)
      • conflict (6)
      • conflict (13)
      • conflict (26)
      • conflict (26)
      • conflict (38)
      • conflict (40)
      • conflict (52)
      • conflict (60)
      • conflict (89)
      • conflict (91)
      • conflict (93)
      • conflict (95)
      • conflict (100)
    Domains in SCOPe 2.03: d1dbkl1, d1dbkl2
  • Heterogens: ANO, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbkH (H:)
    qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
    vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbkL (L:)
    dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
    ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr