PDB entry 1dbh

View 1dbh on RCSB PDB site
Description: dbl and pleckstrin homology domains from hsos1
Deposited on 1998-12-17, released 1998-12-23
The last revision prior to the SCOP 1.55 freeze date was dated 1999-12-29, with a file datestamp of 1999-12-28.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbhA (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesacrfysqqmkgkqlaikkmneiqknidgwegkdi
    gqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmr
    kvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrstl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbhA (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesaaikkmneiqknidgwegkdigqccnefimegtl
    trvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmrkvqindkddtney
    khafeiilkdensvifsaksaeeknnwmaalislqyrstl