PDB entry 1dbh

View 1dbh on RCSB PDB site
Description: dbl and pleckstrin homology domains from hsos1
Class: gene regulation
Keywords: guanine nucleotide exchange factor, gene regulation
Deposited on 1998-12-17, released 1998-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.229
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (human sos 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q07889 (0-End)
      • modified residue (11)
      • modified residue (71)
      • modified residue (189)
      • modified residue (224)
      • modified residue (248)
      • modified residue (270)
      • modified residue (298)
      • modified residue (340)
    Domains in SCOPe 2.07: d1dbha1, d1dbha2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbhA (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesacrfysqqmkgkqlaikkmneiqknidgwegkdi
    gqccnefimegtltrvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmr
    kvqindkddtneykhafeiilkdensvifsaksaeeknnwmaalislqyrstle
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbhA (A:)
    eqtyydlvkafmaeirqyirelnliikvfrepfvsnsklfsandvenifsrivdihelsv
    kllghiedtvemtdegsphplvgscfedlaeelafdpyesyardilrpgfhdrflsqlsk
    pgaalylqsigegfkeavqyvlprlllapvyhclhyfellkqleeksedqedkeclkqai
    tallnvqsgmekicskslakrrlsesaaikkmneiqknidgwegkdigqccnefimegtl
    trvgakherhiflfdglmiccksnhgqprlpgasnaeyrlkekffmrkvqindkddtney
    khafeiilkdensvifsaksaeeknnwmaalislqyrstl