PDB entry 1dbg

View 1dbg on RCSB PDB site
Description: crystal structure of chondroitinase b
Class: lyase
Keywords: beta helix, polysaccharide lyase, dematan sulfate
Deposited on 1999-11-02, released 2000-01-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chondroitinase b
    Species: Pedobacter heparinus [TaxId:984]
    Database cross-references and differences (RAF-indexed):
    • GB U27584 (Start-505)
    Domains in SCOPe 2.07: d1dbga_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1dbgA (A:)
    mkmlnklagyllpimvllnvapclgqvvasnetlyqvvkevkpgglvqiadgtykdvqli
    vsnsgksglpitikalnpgkvfftgdakvelrgehlilegiwfkdgnraiqawkshgpgl
    vaiygsynritacvfdcfdeansayittsltedgkvpqhcridhcsftdkitfdqvinln
    ntaraikdgsvggpgmyhrvdhcffsnpqkpgnagggirigyyrndigrclvdsnlfmrq
    dseaeiitsksqenvyygntylncqgtmnfrhgdhqvainnfyigndqrfgyggmfvwgs
    rhviacnyfelsetiksrgnaalylnpgamasehalafdmliannafinvngyaihfnpl
    derrkeycaanrlkfetphqlmlkgnlffkdkpyvypffkddyfiagknswtgnvalgve
    kgipvnisanrsaykpvkikdiqpiegialdlnaliskgitgkplswdevrpywlkempg
    tyaltarlsadraakfkavikrnkeh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1dbgA (A:)
    qvvasnetlyqvvkevkpgglvqiadgtykdvqlivsnsgksglpitikalnpgkvfftg
    dakvelrgehlilegiwfkdgnraiqawkshgpglvaiygsynritacvfdcfdeansay
    ittsltedgkvpqhcridhcsftdkitfdqvinlnntaraikdgsvggpgmyhrvdhcff
    snpqkpgnagggirigyyrndigrclvdsnlfmrqdseaeiitsksqenvyygntylncq
    gtmnfrhgdhqvainnfyigndqrfgyggmfvwgsrhviacnyfelsetiksrgnaalyl
    npgamasehalafdmliannafinvngyaihfnplderrkeycaanrlkfetphqlmlkg
    nlffkdkpyvypffkddyfiagknswtgnvalgvekgipvnisanrsaykpvkikdiqpi
    egialdlnaliskgitgkplswdevrpywlkempgtyaltarlsadraakfkavikrnke
    h