PDB entry 1dbd

View 1dbd on RCSB PDB site
Description: e2 dna-binding domain from papillomavirus bpv-1
Deposited on 1999-05-21, released 2000-01-01
The last revision prior to the SCOP 1.55 freeze date was dated 2000-02-28, with a file datestamp of 2000-02-28.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d1dbda_
  • Chain 'B':
    Domains in SCOP 1.55: d1dbdb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbdA (A:)
    rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
    qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbdB (B:)
    rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
    qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf