PDB entry 1dbd
View 1dbd on RCSB PDB site
Description: e2 DNA-binding domain from papillomavirus bpv-1
Class: gene regulation
Keywords: DNA-binding domain, gene regulation
Deposited on
1999-05-21, released
2000-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated
2009-02-24, with a file datestamp of
2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Regulatory protein E2
Species: Bovine papillomavirus type 1 [TaxId:10559]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1dbda_ - Chain 'B':
Compound: Regulatory protein E2
Species: Bovine papillomavirus type 1 [TaxId:10559]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.08: d1dbdb_
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1dbdA (A:)
rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1dbdB (B:)
rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf