PDB entry 1dbd

View 1dbd on RCSB PDB site
Description: e2 DNA-binding domain from papillomavirus bpv-1
Class: gene regulation
Keywords: DNA-binding domain, gene regulation
Deposited on 1999-05-21, released 2000-01-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Regulatory protein E2
  Species: Bovine papillomavirus type 1 [TaxId:10559]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03122 (0-99)
  Domains in SCOPe 2.08: d1dbda_
• Chain 'B':
  Compound: Regulatory protein E2
  Species: Bovine papillomavirus type 1 [TaxId:10559]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03122 (0-99)
  Domains in SCOPe 2.08: d1dbdb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dbdA (A:)
  rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
  qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dbdB (B:)
  rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer
  qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf