PDB entry 1dba

View 1dba on RCSB PDB site
Description: three-dimensional structure of an anti-steroid fab' and progesterone-fab' complex
Class: immunoglobulin
Keywords: immunoglobulin
Deposited on 1992-11-10, released 1993-10-31
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.202
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg1-kappa db3 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1dbah1, d1dbah2
  • Chain 'L':
    Compound: igg1-kappa db3 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB09710 (0-215)
      • conflict (1)
      • conflict (6)
      • conflict (13)
      • conflict (26)
      • conflict (26)
      • conflict (38)
      • conflict (40)
      • conflict (52)
      • conflict (60)
      • conflict (89)
      • conflict (91)
      • conflict (93)
      • conflict (95)
      • conflict (100)
    Domains in SCOPe 2.05: d1dbal1, d1dbal2
  • Heterogens: EOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbaH (H:)
    qiqlvqsgpelkkpgetvkisckasgyaftnygvnwvkeapgkelkwmgwiniytgepty
    vddfkgrfafsletsastayleinnlknedtatyfctrgdyvnwyfdvwgagttvtvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dbaL (L:)
    dvvmtqiplslpvnlgdqasiscrssqslihsngntylhwylqkpgqspkllmykvsnrf
    ygvpdrfsgsgsgtdftlkisrveaedlgiyfcsqsshvpptfgggtkleikradaaptv
    sifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysm
    sstltltkdeyerhnsytceathktstspivksfnr