PDB entry 1db9

View 1db9 on RCSB PDB site
Description: protein-DNA recognition and DNA deformation revealed in crystal structures of cap-DNA complexes
Class: gene regulation/DNA
Keywords: protein-DNA complex, cap, cap-DNA, catabolite gene activator protein, camp receptor protein, crp
Deposited on 1999-11-02, released 2001-11-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2003-04-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.26
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: catabolite gene activator protein
    Species: Escherichia coli
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03020 (0-199)
      • engineered (173)
    Domains in SCOPe 2.08: d1db9a3, d1db9a4
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*gp*cp*gp*ap*t)-3'
  • Chain 'C':
    Compound: 5'-d(*cp*tp*ap*gp*ap*tp*cp*gp*cp*ap*tp*tp*tp*tp*t)-3'
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1db9A (A:)
    dptlewflshchihkypskstlihqgekaetlyyivkgsvavlikdeegkemilsylnqg
    dfigelglfeegqersawvraktacevaeisykkfrqliqvnpdilmrlsaqmarrlqvt
    sekvgnlafldvtgriaqtllnlakqpdamthpdgmqikitrqeigqivgcsrdtvgril
    kmledqnlisahgktivvyg
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.