PDB entry 1db3

View 1db3 on RCSB PDB site
Description: e.coli GDP-mannose 4,6-dehydratase
Class: lyase
Keywords: dehydratase, nadp, GDP-mannose, GDP-fucose, lyase
Deposited on 1999-11-02, released 1999-11-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.205
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GDP-mannose 4,6-dehydratase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1db3a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1db3A (A:)
    skvalitgvtgqdgsylaefllekgyevhgikrrassfntervdhiyqdphtcnpkfhlh
    ygdlsdtsnltrilrevqpdevynlgamshvavsfespeytadvdamgtlrlleairflg
    lekktrfyqastselyglvqeipqkettpfyprspyavaklyaywitvnyresygmyacn
    gilfnhesprrgetfvtrkitraianiaqglesclylgnmdslrdwghakdyvkmqwmml
    qqeqpedfviatgvqysvrqfvemaaaqlgiklrfegtgveekgivvsvtghdapgvkpg
    dviiavdpryfrpaevetllgdptkaheklgwkpeitlremvsemvandleaakkhsllk
    shgydvaiales
    

    Sequence, based on observed residues (ATOM records): (download)
    >1db3A (A:)
    skvalitgvtgqdgsylaefllekgyevhgikrpkfhlhygdlsdtsnltrilrevqpde
    vynlgamshvavsfespeytadvdamgtlrlleairflglekktrfyqastselyglvqe
    ipqkettpfyprspyavaklyaywitvnyresygmyacngilfnhesprrgetfvtrkit
    raianiaqglesclylgnmdslrdwghakdyvkmqwmmlqqeqpedfviatgvqysvrqf
    vemaaaqlgiklrfegtgveekgivvsvtghdapgvkpgdviiavdpryfrpaeetllgd
    ptkaheklgwkpeitlremvsemvandleaakkhs