PDB entry 1daz

View 1daz on RCSB PDB site
Description: Structural and kinetic analysis of drug resistant mutants of HIV-1 protease
Class: hydrolase/hydrolase inhibitor
Keywords: hiv-1 protease, hydrolase-hydrolase inhibitor complex, reduced peptide inhibitor
Deposited on 1999-11-01, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.213
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: hiv-1 protease (retropepsin)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367
      • engineered (6)
      • engineered (32)
      • engineered (44)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1dazc_
  • Chain 'D':
    Compound: hiv-1 protease (retropepsin)
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03367 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (44)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d1dazd_
  • Heterogens: 0Q4, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dazC (C:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dazD (D:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpimiggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf