PDB entry 1dax

View 1dax on RCSB PDB site
Description: oxidised desulfovibrio africanus ferredoxin i, nmr, minimized average structure
Deposited on 1997-12-01, released 1999-01-13
The last revision prior to the SCOP 1.61 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: NMRAVE
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d1dax__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dax_ (-)
    arkfyvdqdeciacescveiapgafamdpeiekayvkdvegasqeeveeamdtcpvqcih
    wede