PDB entry 1dat

View 1dat on RCSB PDB site
Description: cubic crystal structure recombinant horse l apoferritin
Deposited on 1996-11-14, released 1997-03-12
The last revision prior to the SCOP 1.71 freeze date was dated 1997-03-12, with a file datestamp of 1997-03-13.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.178
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.71: d1dat__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dat_ (-)
    ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
    gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
    adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd