PDB entry 1dat

View 1dat on RCSB PDB site
Description: cubic crystal structure recombinant horse l apoferritin
Class: iron storage
Keywords: apoferritin, light chain, iron storage
Deposited on 1996-11-14, released 1997-03-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l ferritin
    Species: Equus caballus [TaxId:9796]
    Gene: CDNA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1data_
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1datA (A:)
ssqirqnysteveaavnrlvnlylrasytylslgfyfdrddvalegvchffrelaeekre
gaerllkmqnqrggralfqdlqkpsqdewgttpdamkaaivlekslnqalldlhalgsaq
adphlcdfleshfldeevklikkmgdhltniqrlvgsqaglgeylferltlkhd