PDB entry 1dao

View 1dao on RCSB PDB site
Description: covalent adduct of d-amino acid oxidase from pig kidney with 3-methyl-2-oxo-valeric acid
Class: flavoenzyme
Keywords: flavoenzyme, fad cofactor, oxidoreductase
Deposited on 1997-01-16, released 1997-07-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.232
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daoa1, d1daoa2
  • Chain 'B':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daob1, d1daob2
  • Chain 'C':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daoc1, d1daoc2
  • Chain 'D':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daod1, d1daod2
  • Chain 'E':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daoe1, d1daoe2
  • Chain 'F':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daof1, d1daof2
  • Chain 'G':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daog1, d1daog2
  • Chain 'H':
    Compound: d-amino acid oxidase
    Species: Sus scrofa [TaxId:9823]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1daoh1, d1daoh2
  • Heterogens: FAB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1daoA (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoA (A:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1daoB (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoB (B:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1daoC (C:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoC (C:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1daoD (D:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoD (D:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1daoE (E:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoE (E:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1daoF (F:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoF (F:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1daoG (G:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoG (G:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1daoH (H:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernlltmppshl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daoH (H:)
    mrvvvigagviglstalciheryhsvlqpldvkvyadrftpftttdvaaglwqpytseps
    npqeanwnqqtfnyllshigspnaanmgltpvsgynlfreavpdpywkdmvlgfrkltpr
    eldmfpdyrygwfntslilegrkylqwlterltergvkfflrkvesfeevarggadviin
    ctgvwagvlqpdpllqpgrgqiikvdapwlknfiithdlergiynspyiipglqavtlgg
    tfqvgnwneinniqdhntiwegccrleptlkdakivgeytgfrpvrpqvrlereqlrfgs
    sntevihnyghggygltihwgcalevaklfgkvleernl