PDB entry 1dam

View 1dam on RCSB PDB site
Description: dethiobiotin synthetase complexed with dethiobiotin, ADP, inorganic phosphate and magnesium
Class: ligase
Keywords: ligase, biotin biosynthesis, magnesium, ATP-binding, phosphoryl transfer
Deposited on 1998-08-31, released 1999-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (dethiobiotin synthetase)
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13000 (0-223)
  Domains in SCOPe 2.08: d1dama_
• Heterogens: MG, PO4, ADP, DTB, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1damA (A:)
  skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
  nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
  ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
  gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall