PDB entry 1dak

View 1dak on RCSB PDB site
Description: dethiobiotin synthetase from escherichia coli, complex reaction intermediate ADP and mixed anhydride
Class: ligase
Keywords: phoshporyl transfer, biotin biosynthesis, ligase, kinetic crystallography
Deposited on 1998-03-31, released 1999-04-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.184
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dethiobiotin synthetase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13000 (0-223)
  Domains in SCOPe 2.08: d1daka_
• Heterogens: PO4, MG, DPU, ADP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dakA (A:)
  skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
  nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
  ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
  gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall