PDB entry 1dag

View 1dag on RCSB PDB site
Description: dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid and 5'-adenosyl-methylene-triphosphate
Class: ligase
Keywords: ligase, biotin biosynthesis, magnesium, ATP-binding
Deposited on 1995-05-08, released 1996-06-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.18
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: dethiobiotin synthetase
  Species: Escherichia coli [TaxId:562]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13000 (0-223)
  Domains in SCOPe 2.08: d1daga_
• Heterogens: DSD, ACP, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1dagA (A:)
  skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
  nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
  ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
  gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall