PDB entry 1dae

View 1dae on RCSB PDB site
Description: dethiobiotin synthetase complexed with 3-(1-aminoethyl) nonanedioic acid
Class: ligase
Keywords: ligase, biotin biosynthesis, magnesium, ATP-binding
Deposited on 1995-05-08, released 1996-06-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.178
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dethiobiotin synthetase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1daea_
  • Heterogens: IKT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1daeA (A:)
    skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
    nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
    ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
    gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daeA (A:)
    skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
    nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
    ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
    gkrhaeymttltrmipapllgeipwlaaatgkyinlall