PDB entry 1dad

View 1dad on RCSB PDB site
Description: dethiobiotin synthetase complexed with adp
Deposited on 1995-05-08, released 1996-06-20
The last revision prior to the SCOP 1.57 freeze date was dated 1996-06-20, with a file datestamp of 1996-06-21.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.183
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d1dad__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1dad_ (-)
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall