PDB entry 1dab

View 1dab on RCSB PDB site
Description: The Structure of Bordetella Pertussis Virulence Factor P.69 Pertactin
Class: cell adhesion
Keywords: pertussis beta helix, cell adhesion
Deposited on 1999-10-31, released 1999-12-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p.69 pertactin
    Species: Bordetella pertussis [TaxId:520]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1daba_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1dabA (A:)
    dwnnqsivktgerqhgihiqgsdpggvrtasgttikvsgrqaqgillenpaaelqfrngs
    vtssgqlsddgirrflgtvtvkagklvadhatlanvgdtwdddgialyvageqaqasiad
    stlqgaggvqierganvtvqrsaivdgglhigalqslqpedlppsrvvlrdtnvtavpas
    gapaavsvlgaseltldgghitggraagvaamqgavvhlqratirrgdalaggavpggav
    pggavpggfgpggfgpvldgwygvdvsgssvelaqsiveapelgaairvgrgarvtvpgg
    slsaphgnvietggarrfapqaaplsitlqagahaqgkallyrvlpepvkltltggadaq
    gdivatelpsipgtsigpldvalasqarwtgatravdslsidnatwvmtdnsnvgalrla
    sdgsvdfqqpaeagrfkvltvntlagsglfrmnvfadlglsdklvvmqdasgqhrlwvrn
    sgsepasantlllvqtplgsaatftlankdgkvdigtyryrlaangngqwslvgakapp