PDB entry 1daa

View 1daa on RCSB PDB site
Description: crystallographic structure of d-amino acid aminotransferase complexed with pyridoxal-5'-phosphate
Class: transferase (aminotransferase)
Keywords: transferase, aminotransferase, d-amino acid, d-alanine, pyridoxal phosphate, transferase (aminotransferase)
Deposited on 1995-06-09, released 1995-09-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.184
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-amino acid aminotransferase
    Species: Bacillus sp. [TaxId:72579]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1daaa_
  • Chain 'B':
    Compound: d-amino acid aminotransferase
    Species: Bacillus sp. [TaxId:72579]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1daab_
  • Heterogens: PLP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1daaA (A:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daaA (A:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkip
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1daaB (B:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkipkplhi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1daaB (B:)
    gytlwndqivkdeevkidkedrgyqfgdgvyevvkvyngemftvnehidrlyasaekiri
    tipytkdkfhqllhelveknelntghiyfqvtrgtsprahqfpentvkpviigytkenpr
    plenlekgvkatfvedirwlrcdikslnllgavlakqeahekgcyeailhrnntvtegss
    snvfgikdgilythpannmilkgitrdvviacaneinmpvkeipftthealkmdelfvts
    ttseitpvieidgklirdgkvgewtrklqkqfetkip