PDB entry 1d9z

View 1d9z on RCSB PDB site
Description: crystal structure of the dna repair protein uvrb in complex with atp
Deposited on 1999-10-30, released 2000-05-03
The last revision prior to the SCOP 1.71 freeze date was dated 2000-05-03, with a file datestamp of 2000-05-03.
Experiment type: XRAY
Resolution: 3.15 Å
R-factor: 0.262
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d9zA (A:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrgtfrvrgdvveifpasrdehcirveffgdeierirevdaltgkvlgerehv
    aifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremg
    fcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqvl
    vdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldpt
    idvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseikt
    lerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigra
    arnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdviratya
    aeetemyeakpaaamtkqereelirtleaemkeaakaldferaaqlrdiifelkaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9zA (A:)
    egrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkptl
    viahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeidk
    lrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiqy
    drndifrgtfrvrgdvveifpasrdehcirveffgdeierevdaltgkvlgerehvaifp
    ashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremgfcsg
    ienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqvlvdhg
    frlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldptidvr
    ptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseiktleri
    eiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigraarna
    nghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdv