PDB entry 1d9y

View 1d9y on RCSB PDB site
Description: neisseria gonorrhoeae ferric binding protein
Class: metal binding protein
Keywords: ferric binding protein, periplasmic binding protein, fbpa, ghonnorhea, neisseria, metal binding protein
Deposited on 1999-10-30, released 1999-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: N/A
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (periplasmic iron-binding protein)
    Species: Neisseria gonorrhoeae [TaxId:485]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q50964 (0-308)
      • conflict (31)
    Domains in SCOPe 2.07: d1d9ya_
  • Heterogens: FE, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9yA (A:)
    ditvyngqhkeaaqavadaftratgikvklncakgdqlagqikeegsrspadvfyseqip
    alatlsaanlleplpastinetrgkgvpvaakkdwvalsgrsrvvvydtrklsekdleks
    vlnyatpkwknrigyvptsgafleqivaivklkgeaaalkwlkglkeygkpyaknsvalq
    avengeidaalinnyywhafarekgvqnvhtrlnfvrhrdpgalvtysgaavlkssqnkd
    eakkfvaflagkegqraltavraeyplnphvvstfnlepiakleapqvsattvsekehat
    rlleqagmk