PDB entry 1d9x

View 1d9x on RCSB PDB site
Description: crystal structure of the DNA repair protein uvrb
Class: gene regulation
Keywords: apo protein, GENE REGULATION
Deposited on 1999-10-30, released 2000-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2016-12-14, with a file datestamp of 2016-12-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: excinuclease uvrabc component uvrb
    Species: Bacillus caldotenax [TaxId:1395]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9xa1, d1d9xa2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d9xA (A:)
    vegrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkpt
    lviahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeid
    klrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiq
    ydrndidfrgtfrvrgdvveifpasrdehcirveffgdeieriraevdaltgkvlgereh
    vaifpashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmrem
    gfcsgienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqv
    lvdhgfrlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldp
    tidvrptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseik
    tlerieiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigr
    aarnanghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdviraty
    aaeetemyeakpaaamtkqereelirtleaemkeaakaldferaaqlrdiifelkaeg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9xA (A:)
    egrfqlvapyepqgdqpqaiaklvdglrrgvkhqtllgatgtgktftisnviaqvnkptl
    viahnktlagqlyselkeffphnaveyfvsyydyyqpeayvpqtdtyiekdakindeidk
    lrhsatsalferrdviivasvsciyglgspeeyrelvvslrvgmeiernallrrlvdiqy
    drndifrgtfrvrgdvveifpasrdehcirveffgdeieaevdaltgkvlgerehvaifp
    ashfvtreekmrlaiqnieqeleerlaelraqgklleaqrleqrtrydlemmremgfcsg
    ienysrhlalrppgstpytlldyfpddfliivdeshvtlpqlrgmyngdrarkqvlvdhg
    frlpsaldnrpltfeefeqkinqiiyvsatpgpyelehspgvveqiirptglldptidvr
    ptkgqiddligeirervernertlvttltkkmaedltdylkeagikvaylhseiktleri
    eiirdlrlgkydvlvginllregldipevslvaildadkegflrsersliqtigraarna
    nghvimyadtitksmeiaiqetkrrraiqeeynrkhgivprtvkkeirdv