PDB entry 1d9w

View 1d9w on RCSB PDB site
Description: bacteriophage t4 lysozyme mutant
Class: hydrolase
Keywords: hydrolase (o-glycosyl), t4 lysozyme, helix capping, helix dipole, hydrolase
Deposited on 1999-10-30, released 1999-11-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-02-13, with a file datestamp of 2013-02-08.
Experiment type: XRAY
Resolution: 1.91 Å
R-factor: 0.179
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (lysozyme)
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Gene: GENE E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • engineered (123)
    Domains in SCOPe 2.07: d1d9wa_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d9wA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqdrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9wA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqdrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk