PDB entry 1d9v

View 1d9v on RCSB PDB site
Description: haemophilus influenzae ferric-binding protein apo form
Class: metal binding protein
Keywords: ferric, binding protein, iron, apo form, periplasmic protein, abc cassette receptor protein, metal binding protein
Deposited on 1999-10-30, released 1999-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: N/A
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PROTEIN (iron-utilization periplasmic protein)
    Species: Haemophilus influenzae [TaxId:727]
    Gene: HITA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d9va_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9vA (A:)
    ditvyngqhkeaatavakafeqetgikvtlnsgkseqlagqlkeegdktpadvfyteqta
    tfadlseagllapiseqtiqqtaqkgvplapkkdwialsgrsrvvvydhtklsekdmeks
    vldyatpkwkgkigyvstsgafleqvvalskmkgdkvalnwlkglkengklyaknsvalq
    avengevpaalinnyywynlakekgvenlksrlyfvrhqdpgalvsysgaavlkasknqa
    eaqkfvdflaskkgqealvaaraeyplradvvspfnlepyekleapvvsattaqdkehai
    klieeaglk