PDB entry 1d9t

View 1d9t on RCSB PDB site
Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a
Class: isomerase
Keywords: allosteric enzyme, intramolecular oxidoreductase deaminase
Deposited on 1999-10-29, released 2000-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2003-09-23, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.205
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glucosamine-6-phosphate deaminase isomerase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: protein (glucosamine-6-phosphate deaminase isomerase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: protein (glucosamine-6-phosphate deaminase isomerase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: protein (glucosamine-6-phosphate deaminase isomerase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9td_
  • Chain 'E':
    Compound: protein (glucosamine-6-phosphate deaminase isomerase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9te_
  • Chain 'F':
    Compound: protein (glucosamine-6-phosphate deaminase isomerase)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9tf_
  • Heterogens: GLC, SO4, RAN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d9tD (D:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9tD (D:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1d9tE (E:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9tE (E:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1d9tF (F:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysikeketeksqsskkpysd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9tF (F:)
    mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
    lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
    feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
    vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
    edatlelkvktvkyfkglmlvhnklvdplysike