PDB entry 1d9s

View 1d9s on RCSB PDB site
Description: tumor suppressor p15(ink4b) structure by comparative modeling and nmr data
Class: signaling protein
Keywords: helix-turn-helix, ankyrin repeat, signaling protein
Deposited on 1999-10-29, released 2000-07-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclin-dependent kinase 4 inhibitor b
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P55271 (0-135)
      • see remark 999 (0-5)
    Domains in SCOPe 2.08: d1d9sa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9sA (A:)
    gspgihmlggssdaglataaargqvetvrqlleagadpnalnrfgrrpiqvmmmgsaqva
    ellllhgaepncadpatltrpvhdaaregfldtlvvlhragarldvcdawgrlpvdlaee
    qghrdiarylhaatgd