PDB entry 1d9q

View 1d9q on RCSB PDB site
Description: oxidized pea fructose-1,6-bisphosphatase form 1
Class: hydrolase
Keywords: chloroplast, photosynthesis, redox regulation, thioredoxin, allostery, disulfide bridge, calvin cycle, hydrolase
Deposited on 1999-10-29, released 1999-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.186
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9qa_
  • Chain 'B':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9qb_
  • Chain 'C':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9qc_
  • Chain 'D':
    Compound: fructose-1,6-bisphosphatase
    Species: Pisum sativum [TaxId:3888]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9qd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d9qA (A:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9qA (A:)
    iitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgedqkkldvisn
    evfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgi
    yspndeclpntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftldpl
    ygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigslv
    gdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqpte
    ihqrvplyigsteevekvekyla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d9qB (B:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9qB (B:)
    yeiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgedqkkldvi
    snevfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsif
    giyspndeclpdfgddsddntlgteeqrcivnvcqpgsnllaagycmysssvifvltigk
    gvfvftldplygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkp
    ysaryigslvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdgh
    qrvldiqpteihqrvplyigsteevekvekyla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d9qC (C:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9qC (C:)
    iitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltgedqkkldvisn
    evfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgi
    yspndeclpdfgdntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvft
    ldplygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryi
    gslvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldi
    qpteihqrvplyigsteevekvekyla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d9qD (D:)
    mavkeatsetkkrsgyeiitltswllqqeqkgiidaeltivlssismackqiaslvqran
    isnltgtqgavniqgedqkkldvisnevfsnclrssgrtgiiaseeedvpvaveesysgn
    yivvfdpldgssnldaavstgsifgiyspndeclpdfgddsddntlgteeqrcivnvcqp
    gsnllaagycmysssvifvltigkgvfvftldplygefvltqenlqipksgkiysfnegn
    yklwdenlkkyiddlkepgpsgkpysaryigslvgdfhrtllyggiygyprdkkskngkl
    rllyecapmsfiveqaggkgsdghqrvldiqpteihqrvplyigsteevekvekyla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9qD (D:)
    eiitltswllqqeqkgiidaeltivlssismackqiaslvqranisnltedqkkldvisn
    evfsnclrssgrtgiiaseeedvpvaveesysgnyivvfdpldgssnldaavstgsifgi
    yspndeclpddntlgteeqrcivnvcqpgsnllaagycmysssvifvltigkgvfvftld
    plygefvltqenlqipksgkiysfnegnyklwdenlkkyiddlkepgpsgkpysaryigs
    lvgdfhrtllyggiygyprdkkskngklrllyecapmsfiveqaggkgsdghqrvldiqp
    teihqrvplyigsteevekvekyla