PDB entry 1d9n

View 1d9n on RCSB PDB site
Description: solution structure of the methyl-cpg-binding domain of the methylation-dependent transcriptional repressor mbd1/pcm1
Deposited on 1999-10-28, released 2000-10-28
The last revision prior to the SCOP 1.57 freeze date was dated 2000-10-28, with a file datestamp of 2000-10-28.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d9na_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9nA (A:)
    maedwldcpalgpgwkrrevfrksgatcgrsdtyyqsptgdrirskveltrylgpacdlt
    lfdfkqgilcypapk