PDB entry 1d9k

View 1d9k on RCSB PDB site
Description: crystal structure of complex between d10 tcr and pmhc I-ak/ca
Class: immune system
Keywords: T-cell receptor, MHC class II, d10, I-ak, immune system
Deposited on 1999-10-28, released 1999-12-15
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.2 Å
R-factor: 0.247
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: T-cell receptor d10 (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41229 (0-109)
      • engineered (107)
    Domains in SCOPe 2.05: d1d9ka_
  • Chain 'B':
    Compound: T-cell receptor d10 (beta chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-108)
      • see remark 999 (108)
      • see remark 999 (108)
    Domains in SCOPe 2.05: d1d9kb_
  • Chain 'C':
    Compound: MHC I-ak a chain (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d9kc1, d1d9kc2
  • Chain 'D':
    Compound: MHC I-ak b chain (beta chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06343 (0-187)
      • conflict (0)
    Domains in SCOPe 2.05: d1d9kd1, d1d9kd2
  • Chain 'E':
    Compound: T-cell receptor d10 (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41229 (0-109)
      • engineered (107)
    Domains in SCOPe 2.05: d1d9ke_
  • Chain 'F':
    Compound: T-cell receptor d10 (beta chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAB41230 (0-108)
      • see remark 999 (108)
      • see remark 999 (108)
    Domains in SCOPe 2.05: d1d9kf_
  • Chain 'G':
    Compound: MHC I-ak a chain (alpha chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1d9kg1, d1d9kg2
  • Chain 'H':
    Compound: MHC I-ak b chain (beta chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06343 (0-187)
      • conflict (0)
    Domains in SCOPe 2.05: d1d9kh1, d1d9kh2
  • Chain 'P':
    Compound: conalbumin peptide
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1D9K (0-15)
  • Chain 'Q':
    Compound: conalbumin peptide
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1D9K (0-15)
  • Heterogens: NDG

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kA (A:)
    qvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kB (B:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kC (C:)
    ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
    lqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pei
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kD (D:)
    gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
    nkqylertraeldtvcrhnyektetptslrrleqpsvvislsrtealnhhntlvcsvtdf
    ypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslks
    pitvewra
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kE (E:)
    qvrqspqsltvwegettilncsyedstfdyfpwyrqfpgkspalliaislvsnkkedgrf
    tiffnkrekklslhitdsqpgdsatyfcaatgsfnkltfgagtrlavspy
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kF (F:)
    avtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdipd
    gykasrpsqenfslilelatpsqtsvyfcasggqgraeqffgpgtrltvlgs
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kG (G:)
    ieadhvgsygitvyqspgdigqytfefdgdelfyvdldkketvwmlpefaqlrrfepqgg
    lqniatgkhnleiltkrsnstpatneapqatvfpkspvllgqpntlicfvdnifppvini
    twlrnsksvtdgvyetsffvnrdysfhklsyltfipsdddiydckvehwgleepvlkhwe
    pei
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9kH (H:)
    gserhfvhqfqpfcyftngtqrirlviryiynreeyvrfdsdvgeyravtelgrpdaeyw
    nkqylertraeldtvcrhnyektetptslrrleqpsvvislsrtealnhhntlvcsvtdf
    ypakikvrwfrngqeetvgvsstqlirngdwtfqvlvmlemtprrgevytchvehpslks
    pitvewra
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.