PDB entry 1d9i

View 1d9i on RCSB PDB site
Description: structure of thrombin complexed with selective non-electophilic inhibitors having cyclohexyl moieties at p1
Class: hydrolase/hydrolase inhibitor
Keywords: globular, hydrolase-hydrolase inhibitor complex
Deposited on 1999-10-27, released 2000-10-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9ia_
  • Chain 'I':
    Compound: hirugen
    Species: Hirudo medicinalis, synthetic [TaxId:6421]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: NA, 00P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d9iA (A:)
    adcglrplfekksledkterellesyidgrivegsdaeigmspwqvmlfrkspqellcga
    slisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpry
    nwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwta
    nvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfv
    mkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9iA (A:)
    adcglrplfekksledkterellesyidivegsdaeigmspwqvmlfrkspqellcgasl
    isdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihprynw
    renldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketgqpsv
    lqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrw
    yqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfg
    

  • Chain 'I':
    No sequence available.