PDB entry 1d9g

View 1d9g on RCSB PDB site
Description: bovine interferon-gamma at 2.9 angstroms
Class: immune system
Keywords: helical homodimer, IMMUNE SYSTEM
Deposited on 1999-10-27, released 1999-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: N/A
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interferon-gamma
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d9ga_
  • Chain 'B':
    Compound: interferon-gamma
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1d9gb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9gA (A:)
    qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
    kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmndl
    s
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d9gB (B:)
    qgqffreienlkeyfnasspdvakggplfseilknwkdesdkkiiqsqivsfyfklfenl
    kdnqviqrsmdiikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmndl
    s
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9gB (B:)
    qffreienlkeyfnggplfseilknwkdesdkkiiqsqivsfyfklfenlkdnqviqrsm
    diikqdmfqkflngssekledfkkliqipvddlqiqrkainelikvmndls