PDB entry 1d9e

View 1d9e on RCSB PDB site
Description: structure of e. coli kdo8p synthase
Deposited on 1999-10-27, released 2000-05-10
The last revision prior to the SCOP 1.57 freeze date was dated 2000-05-10, with a file datestamp of 2000-05-10.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.199
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.57: d1d9ea_
  • Chain 'B':
    Domains in SCOP 1.57: d1d9eb_
  • Chain 'C':
    Domains in SCOP 1.57: d1d9ec_
  • Chain 'D':
    Domains in SCOP 1.57: d1d9ed_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d9eA (A:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9eA (A:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpepsalpla
    klepflkqmkaiddlvkgfeeldtsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d9eB (B:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9eB (B:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpepsalpla
    klepflkqmkaiddlvkgfeeldtsk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d9eC (C:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9eC (C:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpepsalpla
    klepflkqmkaiddlvkgfeeldtsk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d9eD (D:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqcrdpfgaasggrraqvaelaragmavglaglfiea
    hpdpehakcdgpsalplaklepflkqmkaiddlvkgfeeldtsk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d9eD (D:)
    mkqkvvsigdinvandlpfvlfggmnvlesrdlamricehyvtvtqklgipyvfkasfdk
    anrssihsyrgpgleegmkifqelkqtfgvkiitdvhepsqaqpvadvvdviqlpaflar
    qtdlveamaktgavinvkkpqfvspgqmgnivdkfkeggnekvilcdrganfgydnlvvd
    mlgfsimkkvsgnspvifdvthalqraqvaelaragmavglaglfieahpdpsalplakl
    epflkqmkaiddlvkgfeeldtsk