PDB entry 1d9b

View 1d9b on RCSB PDB site
Description: crystal structure of ketoacyl-acp synthase III (fabh)
Class: transferase
Keywords: beta sheet, fabh, condensing enzymes
Deposited on 1999-10-27, released 1999-12-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2000-12-27, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ketoacyl-acp synthase III
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9ba1, d1d9ba2
  • Chain 'B':
    Compound: ketoacyl-acp synthase III
    Species: Escherichia coli
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d9bb1, d1d9bb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9bA (A:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d9bB (B:)
    mytkiigtgsylpeqvrtnadlekmvdtsdewivtrtgirerhiaapnetvstmgfeaat
    raiemagiekdqiglivvattsathafpsaacqiqsmlgikgcpafdvaaacagftyals
    vadqyvksgavkyalvvgsdvlartcdptdrgtiiifgdgagaavlaaseepgiisthlh
    adgsygelltlpnadrvnpensihltmagnevfkvavtelahivdetlaannldrsqldw
    lvphqanlriisatakklgmsmdnvvvtldrhgntsaasvpcaldeavrdgrikpgqlvl
    leafgggftwgsalvrf