PDB entry 1d8z

View 1d8z on RCSB PDB site
Description: solution structure of the first RNA-binding domain (rbd1) of hu antigen c (huc)
Class: RNA binding protein
Keywords: RNA-BINDING DOMAIN, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics, RNA BINDING PROTEIN
Deposited on 1999-10-26, released 2000-04-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hu antigen c
  Species: Mus musculus [TaxId:10090]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q60900 (1-88)
    • conflict (0)
  Domains in SCOPe 2.08: d1d8za_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1d8zA (A:)
  mdsktnlivnylpqnmtqdefkslfgsigdiescklvrdkitgqslgygfvnysdpndad
  kaintlnglklqtktikvsyarpssasir