PDB entry 1d8y

View 1d8y on RCSB PDB site
Description: crystal structure of the complex of dna polymerase i klenow fragment with dna
Deposited on 1999-10-26, released 1999-12-02
The last revision prior to the SCOP 1.67 freeze date was dated 1999-12-02, with a file datestamp of 1999-12-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8yA (A:)
    misydnyvtildeetlkawiaklekapvfafatatdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpggapstseevleelaldypl
    pkvileyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrn
    eegrrirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfg
    lpletvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleyme
    rtraqakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiav
    dawlqaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgen
    wdqah
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8yA (A:)
    misydnyvtildeetlkawiaklekapvfafatatdsldnisanlvglsfaiepgvaayi
    pvahdyldapdqisreralellkplledekalkvgqnlkydrgilanygielrgiafdtm
    lesyilnsvagrhdmdslaerwlkhktitfeeiagkgknqltfnqialeeagryaaedad
    vtlqlhlkmwpdlqkhkgplnvfeniemplvpvlsrierngvkidpkvlhnhseeltlrl
    aelekkaheiageefnlsstkqlqtilfekqgikplkktpstseevleelaldyplpkvi
    leyrglaklkstytdklplminpktgrvhtsyhqavtatgrlsstdpnlqnipvrneegr
    rirqafiapedyvivsadysqielrimahlsrdkglltafaegkdihrataaevfglple
    tvtseqrrsakainfgliygmsafglarqlniprkeaqkymdlyferypgvleymertra
    qakeqgyvetldgrrlylpdikssngarraaaeraainapmqgtaadiikramiavdawl
    qaeqprvrmimqvhdelvfevhkddvdavakqihqlmenctrldvpllvevgsgenwdqa
    h