PDB entry 1d8w

View 1d8w on RCSB PDB site
Description: l-rhamnose isomerase
Class: isomerase
Keywords: beta-alpha-8-barrels, aldose-ketose isomerization, hydride shift, isomerase
Deposited on 1999-10-26, released 2000-09-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32170
      • modified residue (43)
      • modified residue (89)
      • modified residue (188)
      • modified residue (196)
      • modified residue (252)
      • modified residue (283)
      • modified residue (351)
      • modified residue (396)
    Domains in SCOPe 2.07: d1d8wa_
  • Chain 'B':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32170
      • modified residue (43)
      • modified residue (89)
      • modified residue (188)
      • modified residue (196)
      • modified residue (252)
      • modified residue (283)
      • modified residue (351)
      • modified residue (396)
    Domains in SCOPe 2.07: d1d8wb_
  • Chain 'C':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32170
      • modified residue (43)
      • modified residue (89)
      • modified residue (188)
      • modified residue (196)
      • modified residue (252)
      • modified residue (283)
      • modified residue (351)
      • modified residue (396)
    Domains in SCOPe 2.07: d1d8wc_
  • Chain 'D':
    Compound: l-rhamnose isomerase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32170 (7-End)
      • modified residue (7)
      • modified residue (43)
      • modified residue (89)
      • modified residue (188)
      • modified residue (196)
      • modified residue (252)
      • modified residue (283)
      • modified residue (351)
      • modified residue (396)
    Domains in SCOPe 2.07: d1d8wd_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1d8wA (A:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8wA (A:)
    tqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenypgkarnaselr
    adleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewakanqlgldfnpscf
    shplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvmniwipdgmkditvd
    rlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsnefymgyatsrqtal
    cldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvllddetqaiaseivrhd
    lfdrvhigldffdasinriaawvigtrnmkkallralleptaelrkleapgdytarlall
    eeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1d8wB (B:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8wB (B:)
    ttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfeypgkarnaselr
    adleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewakanqlgldfnpscf
    shplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvmniwipdgmkditvd
    rlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsnefymgyatsrqtal
    cldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvllddetqaiaseivrhd
    lfdrvhigldffdasinriaawvigtrnmkkallralleptaelrkleapgdytarlall
    eeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1d8wC (C:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8wC (C:)
    tqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfeypgkarnaselra
    dleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewakanqlgldfnpscfs
    hplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvmniwipdgmkditvdr
    laprqrllaaldeviseklnpahhidavesklfgigaesytvgsnefymgyatsrqtalc
    ldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvllddetqaiaseivrhdl
    fdrvhigldffdasinriaawvigtrnmkkallralleptaelrkleapgdytarlalle
    eqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1d8wD (D:)
    ghhhhhhmttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfenpeg
    sltggiqatgnypgkarnaselradleqamrlipgpkrlnlhaiylesdtpvsrdqikpe
    hfknwvewakanqlgldfnpscfshplsadgftlshaddsirqfwidhckasrrvsayfg
    eqlgtpsvmniwipdgmkditvdrlaprqrllaaldeviseklnpahhidavesklfgig
    aesytvgsnefymgyatsrqtalcldaghfhptevisdkisaamlyvpqlllhvsrpvrw
    dsdhvvllddetqaiaseivrhdlfdrvhigldffdasinriaawvigtrnmkkallral
    leptaelrkleapgdytarlalleeqkslpwqavwemycqrhdtpagsewlesvrayeke
    ilsrrg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1d8wD (D:)
    mttqleqawelakqrfaavgidveealrqldrlpvsmhcwqgddvsgfeypgkarnasel
    radleqamrlipgpkrlnlhaiylesdtpvsrdqikpehfknwvewakanqlgldfnpsc
    fshplsadgftlshaddsirqfwidhckasrrvsayfgeqlgtpsvmniwipdgmkditv
    drlaprqrllaaldeviseklnpahhidavesklfgigaesytvgsnefymgyatsrqta
    lcldaghfhptevisdkisaamlyvpqlllhvsrpvrwdsdhvvllddetqaiaseivrh
    dlfdrvhigldffdasinriaawvigtrnmkkallralleptaelrkleapgdytarlal
    leeqkslpwqavwemycqrhdtpagsewlesvrayekeilsrr