PDB entry 1d8v

View 1d8v on RCSB PDB site
Description: the restrained and minimized average nmr structure of map30.
Class: antitumor protein
Keywords: single chain, antitumor protein
Deposited on 1999-10-26, released 1999-11-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: anti-hiv and anti-tumor protein map30
    Species: Momordica charantia [TaxId:3673]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24817 (0-262)
      • conflict (13)
    Domains in SCOPe 2.08: d1d8va_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1d8vA (A:)
dvnfdlstataktytkfiedfratlpfshkvydipllystisdsrrfillnltsyayeti
svaidvtnvyvvayrtrdvsyffkesppeaynilfkgtrkitlpytgnyenlqtaahkir
enidlglpalssaittlfyynaqsapsallvliqttaeaarfkyierhvakyvatnfkpn
laiislenqwsalskqiflaqnqggkfrnpvdlikptgerfqvtnvdsdvvkgnikllln
srastadenfittmtllgesvvn