PDB entry 1d8r

View 1d8r on RCSB PDB site
Description: structural studies on bio-active compounds. crystal structure and molecular modeling studies on the pneumocystis carinii dihydrofolate reductase cofactor complex with tab, a highly selective antifolate.
Class: oxidoreductase
Keywords: tab, nadph, molecular modeling
Deposited on 1999-10-25, released 2000-10-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-01-20, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (dihydrofolate reductase)
    Species: Pneumocystis carinii
    Gene: C-DNA P.CARINII DHFR
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1d8ra_
  • Heterogens: NDP, TAB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d8rA (A:)
    nqqksltlivalttsygigrsnslpwklkkeisyfkrvtsfvptfdsfesmnvvlmgrkt
    wesiplqfrplkgrinvvitrnesldlgngihsaksldhalellyrtygsessvqinrif
    viggaqlykaamdhpkldrimatiiykdihcdvffplkfrdkewssvwkkekhsdleswv
    gtkvphgkinedgfdyefemwtrdl